SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017036 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017036
Domain Number 1 Region: 12-171
Classification Level Classification E-value
Superfamily EF-hand 4.39e-43
Family Calmodulin-like 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017036   Gene: ENSBTAG00000012823   Transcript: ENSBTAT00000017036
Sequence length 205
Comment pep:known chromosome:UMD3.1:23:15901126:15908139:1 gene:ENSBTAG00000012823 transcript:ENSBTAT00000017036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNIMDGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPWASQYVEQMF
ETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIR
AINPCSDSTMTAEEFTDTVFSKIDVNGDGELSLEEFMEGVQKDQMLLDTLTRSLDLTRIV
RRLQNGEQDEEGASGRETEAAEADG
Download sequence
Identical sequences A0A212D5K4 P46065
ENSBTAP00000017036 NP_776971.1.59421 NP_776971.1.76553 XP_014335033.1.15283 XP_019840722.1.53367 XP_020739924.1.74333 XP_020739925.1.74333 XP_020739926.1.74333 XP_020739927.1.74333 XP_020739928.1.74333 9913.ENSBTAP00000017036 ENSBTAP00000017036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]