SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017060 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017060
Domain Number 1 Region: 118-214
Classification Level Classification E-value
Superfamily EF-hand 2.03e-26
Family Eps15 homology domain (EH domain) 0.0000284
Further Details:      
 
Domain Number 2 Region: 265-364
Classification Level Classification E-value
Superfamily EF-hand 5.36e-25
Family Eps15 homology domain (EH domain) 0.0000784
Further Details:      
 
Domain Number 3 Region: 17-105
Classification Level Classification E-value
Superfamily EF-hand 4.41e-17
Family Eps15 homology domain (EH domain) 0.0000908
Further Details:      
 
Domain Number 4 Region: 386-499
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000204
Family Myosin rod fragments 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017060   Gene: ENSBTAG00000009990   Transcript: ENSBTAT00000017060
Sequence length 797
Comment pep:known chromosome:UMD3.1:7:6484001:6590069:1 gene:ENSBTAG00000009990 transcript:ENSBTAT00000017060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPLIPLSQQIPAGNPLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLA
DPEGKGYLDKQGFYVALRLVACAQSGHEVTLSNLNLNMPPPKFHDSSSPLMVTAPSAEAH
WAVRVEEKAKFDGIFESLLPVNGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLD
RDEFAVAMHLVYRALEKEPVPSVLPPSLIPPSKRKKTMFAGAVPVLPASPPPKDSLRSTP
SHGSVSSLNSTGSLSPKHSIKQAQPTVSWVVPVADKMRFDEIFLKTDLDLDGYVSGQEVK
EIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDPPQVLSPDMVP
PSERGTPIPDSSSTLGSGEFTGVKELDDISQEISQLQREKYSLEQDIREKEEAIRQKTNE
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSL
KTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGKVQLETIIKSLKSTQDEI
NQARSRLSQLHESHREAQRSLEQHDEMLDGAPGVSLSSLADLSTGVSLTERGGFGAMDDP
FKNKALLFSNNAQELHPDPFQAEDPFKSDPFKGADPFKGDPFQSDPFAEQQTASTDPFGG
DPFKESDPFRGSTPDDFFKKQTKSDPFTSDPFTKNPSLPSKLDPFESSDPFSSSTVSSKG
SGPFGALDPFGSGSFSSAEGFADFSQMSKFGNEEQQLAWAKRESEKAEQERLARLRRQEQ
EDLELAIALSKADMPAA
Download sequence
Identical sequences A7MB30
ENSBTAP00000017060 NP_001095341.1.59421 NP_001095341.1.76553 ENSBTAP00000017060 9913.ENSBTAP00000017060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]