SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017095 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017095
Domain Number 1 Region: 223-478
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.81e-57
Family Glycerophosphoryl diester phosphodiesterase 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017095   Gene: ENSBTAG00000012863   Transcript: ENSBTAT00000017095
Sequence length 539
Comment pep:known chromosome:UMD3.1:X:85309754:85319162:-1 gene:ENSBTAG00000012863 transcript:ENSBTAT00000017095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESPGCCSVWARCFHCLYSCHWKKCPRDRMQTNKCECVWFGLLFLTFLLSLGWLYVVLI
LLNDLHNFNEFLFQRWGHWMDWSPAFLLVISLLVTYASLLLLLALLLWLYGQPLCLHTVH
KVLLLLIIFLVAAGLVGLEVQWQEEWHSLRLSLQATAPFLHIGAAAGITLLAWPVADTFY
HIHRRGPKILLLLLYFGATLGIYLAPLFISSACIMEPKDLPHKPKLIGHRGAPMLAPENT
LMSLRKTAECGAIVFETDVMVSSDGIPFLMHDERLTRTTDVASVFPDRVNSHSSDFSWAE
LKRLNAGAWFLQRQPFWGAKQLSGHDQEDAESQTVPSLEEILKEAEGLNLSIIFDLRCPP
ENHTYHDSFVNQTLETVLSSGVPQAMVLWLPDEDRAYVQERAPQMRQIYGHLEGHGTESP
QFLNLPYQDLPLLDIKALHHDNVSVNLFVVNKPWLFSLLWCAGVDSVTTNDCQLLQQMRY
PVWLIPARTYLIIWIITNCVSLLLLLWTFLLQQRCAKERQRTGLETAVLLTRINNFIRE
Download sequence
Identical sequences F1MCP4
ENSBTAP00000017095 9913.ENSBTAP00000017095 NP_001029643.2.59421 NP_001029643.2.76553 XP_005228064.1.76553 XP_005228066.1.76553 XP_015317133.1.76553 XP_015317134.1.76553 XP_015317135.1.76553 XP_019811703.1.53367 ENSBTAP00000017095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]