SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017229 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017229
Domain Number 1 Region: 395-618
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.44e-76
Family ATP sulfurylase catalytic domain 0.00000000149
Further Details:      
 
Domain Number 2 Region: 225-392
Classification Level Classification E-value
Superfamily PUA domain-like 7.36e-53
Family ATP sulfurylase N-terminal domain 0.0000000272
Further Details:      
 
Domain Number 3 Region: 34-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.31e-41
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017229   Gene: ENSBTAG00000012961   Transcript: ENSBTAT00000017229
Sequence length 624
Comment pep:known chromosome:UMD3.1:6:18740229:18854669:1 gene:ENSBTAG00000012961 transcript:ENSBTAT00000017229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPGSLCKKVKLSNNAQNWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGL
SGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLF
ADAGLVCITSFISPYTQDRNNARRIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAG
EIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVP
ENKLHLAKTDAETLPALKINKVDLQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGG
VINLSVPIVLTATQEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTC
KNHPYIKMVMEQGDWLIGGDLQVLDRIYWNDGLDQYRFTPTELKQKFKDMNADAVFAFQL
RNPVHNGHALLMQDTHRQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGV
LNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPT
HGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQK
PPEGFMAPKAWDVLMEYYKSLEKA
Download sequence
Identical sequences Q3T0J0
ENSBTAP00000017229 NP_001029382.1.59421 NP_001029382.1.76553 XP_006061943.1.26621 XP_010856878.1.44457 9913.ENSBTAP00000017229 ENSBTAP00000017229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]