SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017232 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017232
Domain Number 1 Region: 154-461
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.09e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000256
Further Details:      
 
Domain Number 2 Region: 3-72,100-144
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00000000429
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017232   Gene: ENSBTAG00000012962   Transcript: ENSBTAT00000017232
Sequence length 514
Comment pep:known chromosome:UMD3.1:3:34283445:34303242:-1 gene:ENSBTAG00000012962 transcript:ENSBTAT00000017232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDLDLFRVDKGGDPALIRESQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGNDESIPEDVLNLDDLTADTLTNLKVSQIKKVRLLVDEAILKCDAE
RIKLEAERFESLREIGNLLHPSVPISDDEDADNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAVVAGSRGYFLKGVLVFLEQALIQFALRTLASRGYTPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYEEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMIATAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV
EFVHMLNATMCATTRTICAILENYQTEKGILVPEKLKEFMPPGLQELIPFVKAAPIDQEP
SKKQKKQHEGSKKKGAARDVALESQLQNMEVTDA
Download sequence
Identical sequences Q9GMB8
ENSBTAP00000017232 9913.ENSBTAP00000017232 NP_776600.1.59421 NP_776600.1.76553 XP_019812494.1.53367 ENSBTAP00000017232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]