SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017319 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017319
Domain Number 1 Region: 54-133
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000019
Family S100 proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017319   Gene: ENSBTAG00000013026   Transcript: ENSBTAT00000017319
Sequence length 147
Comment pep:known chromosome:UMD3.1:22:37867680:37884047:-1 gene:ENSBTAG00000013026 transcript:ENSBTAT00000017319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGCVHSTQDQALRLEGEPNPPAAPTSTLAPKNMPKRISLYRCLQSIKALRKGSDLEKAI
ATAALVFRNSSDPDGKLRKATAKNLLQTQFKNFAEGQETKARYKDLLSELDEHTENKLDF
EDFMVLLLSVTIMSDLLQNIWSVKITQ
Download sequence
Identical sequences F1MC82
ENSBTAP00000017319 ENSBTAP00000017319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]