SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017359 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017359
Domain Number 1 Region: 7-247
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-76
Family Eukaryotic proteases 0.0000000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017359   Gene: ENSBTAG00000013055   Transcript: ENSBTAT00000017359
Sequence length 255
Comment pep:known chromosome:UMD3.1:21:35211414:35213420:-1 gene:ENSBTAG00000013055 transcript:ENSBTAT00000017359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLLLLVALLSPTGEAGKIIGGHEAKPHSRPYMAFLQVKTSGKSHNCGGFLVREDFVLT
AAHCLGRPFLLSINVTLGAHNIMERERKQQVIPMRRAIPHPCYNKKTWANDIMLLKLTRK
ADITDAVSPIDLPRRLAKVKPGMMCSVAGWGQLGVNMPSTDKLQEVDLEVQSEEECIARF
KKYIPSKQICAGNPSKRKNSFSGDSGGPLVCDGVAQGIVSYGRKDGTTPDVYTRISSFLS
WIHSTMRRYKRQGSV
Download sequence
Identical sequences E1BLE0
ENSBTAP00000017359 ENSBTAP00000017359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]