SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017366 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017366
Domain Number 1 Region: 921-1048,1080-1286
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-78
Family p120GAP domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 6-157
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-35
Family Calponin-homology domain, CH-domain 0.0000397
Further Details:      
 
Domain Number 3 Region: 1503-1600
Classification Level Classification E-value
Superfamily RGC domain-like 9.02e-33
Family RGC domain 0.00000197
Further Details:      
 
Domain Number 4 Region: 584-786
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000165
Family Nucleotide and nucleoside kinases 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017366   Gene: ENSBTAG00000013060   Transcript: ENSBTAT00000017366
Sequence length 1600
Comment pep:known_by_projection chromosome:UMD3.1:21:22530902:22614701:-1 gene:ENSBTAG00000013060 transcript:ENSBTAT00000017366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSEVFPQWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRY
KATGLHFRHTDNVIQWLNAMGEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLG
LAPQIQDLYGKVDFTEEEINNMKIELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIA
INEAIDHRIPADTFTALKNPNAMLVNLEECLASTYQDILYQAKQDKMANAKNRRERDVYE
ELLTQAEIQGNINKVNLLAALTNIDLALEQGSAPALFKILQSPALGLRGLQQQNSDWYLK
QLLSDRQQKRQGGQAEPLQKEELQSGVDAANTAAQEYQRRLAAVAAINAAIQKGVAEKTV
LELMNPEAQLPQVYPFAADLYQKELATLQQQSPEHSLTHPELSVAVEMLSSVALINRALE
SGDMNTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKAQARAENNEFITWNDIQASVDHV
NRVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLSEVAQHYQDTLIRAKR
EKAQETQDESAVLWLDEIQGGIWQSNKDTQEAQRFALGIFAINEAVEKGDVGKTLSALRS
PDVGLYGVIPECGETYQSDLAEAKKKKLAADNNSKWVKHWVKGGYHYYHNLETQEGGWDE
PSDFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITKLQACCRGYLVRQEFRSRM
NFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVIKIQSLARMHQARKRYRERL
QYFRDHINDIIKIQAFIRANKARDDYKTLINAEDPPMIVVRKFVHLLDQSDQDFQEELDL
MKMREEVITLIRSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMM
MLNKQKGGLKALSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTL
YNYASNQREEYLLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALR
QILAPVVKEIMDDKTLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALSHEEVRT
RLDNSIRNMRAVTDKFLAAIISSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGN
LLYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLS
IINEYLSQSYQKFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLL
LDHQDAIAPEHNDPIHELLDDLGEVPTIESLIGAGNLNDPNKEALAKTEVSLTLTNKFDV
PGDENAEMDARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRD
AKTPDKMKKSKTIKEDSSLSLQEKKEKIQSGLKKLTELGTVDPKNRYQELINDIARDIRN
QRRYRQRRKAELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKEMKGKKSK
KISLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFML
HYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYEK
Download sequence
Identical sequences F1MC48
ENSBTAP00000017366 ENSBTAP00000017366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]