SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017401 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017401
Domain Number 1 Region: 25-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-77
Family Eukaryotic proteases 0.00000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017401   Gene: ENSBTAG00000013085   Transcript: ENSBTAT00000017401
Sequence length 270
Comment pep:known chromosome:UMD3.1:2:131425507:131432711:-1 gene:ENSBTAG00000013085 transcript:ENSBTAT00000017401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMIQLLSFLLLVALASGFSQPFSRPSSRVVNGEDAVPYSWSWQVSLQYEKDGAFHHTCGG
SLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVAC
GNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQEALL
PVVDYEHCSQWDWWGISVKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVASFVS
AFGCNTIKKPTVFTRVSAFIDWIDETIASN
Download sequence
Identical sequences F1MSF5
ENSBTAP00000017401 ENSBTAP00000017401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]