SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017447 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017447
Domain Number 1 Region: 313-485,518-682
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.14e-121
Family Mammalian PLC 0.000000083
Further Details:      
 
Domain Number 2 Region: 914-968,1008-1158
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 6.28e-59
Family C-terminal domain of PLC-beta 0.0012
Further Details:      
 
Domain Number 3 Region: 141-312
Classification Level Classification E-value
Superfamily EF-hand 9.43e-55
Family EF-hand modules in multidomain proteins 0.00045
Further Details:      
 
Domain Number 4 Region: 12-140
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-40
Family Pleckstrin-homology domain (PH domain) 0.00079
Further Details:      
 
Domain Number 5 Region: 704-819
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.34e-27
Family PLC-like (P variant) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017447   Gene: ENSBTAG00000013116   Transcript: ENSBTAT00000017447
Sequence length 1194
Comment pep:known chromosome:UMD3.1:13:2211089:2410692:1 gene:ENSBTAG00000013116 transcript:ENSBTAT00000017447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSVRLGATPKDPKILAALEALGKSENDLEGRIVCVCSGADLVNISFTYMVAENPE
ITKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKQGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCSIVEIE
RWSGEKKSQEQIFTKYDALVVDVLLKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVNILEDDNEEEIESAEQEEEAHPEYKYGSELSADDLGHKEAIANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LGAGLEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELSSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKLTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSDMINTHSAEEQEIRDLHLSQQCELLRKLLISAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSCVKLQDTN
Download sequence
Identical sequences F1MSD7
ENSBTAP00000017447 ENSBTAP00000017447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]