SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017607 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017607
Domain Number 1 Region: 16-249
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-72
Family Eukaryotic proteases 0.000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017607   Gene: ENSBTAG00000013234   Transcript: ENSBTAT00000017607
Sequence length 249
Comment pep:known chromosome:UMD3.1:21:35168813:35171314:1 gene:ENSBTAG00000013234 transcript:ENSBTAT00000017607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLLLLVAFLLSPRARAGQIIGGREARPHSRPYMAYIQIRSPVGIKVCGGFLVREDFVM
TAAHCLGRFSFLCSQINVILGAHNIRTLESTQQRIPVLRSIPHPGYSQQNKRNDIMLLQL
ANRAQRNRFVRPVPLPQTQNRLRPGTQCTVAGWGLIGLNMRTDTLQCVQLRVQRDRVCRR
RFMLYYGRTQICVGDPRQRKSAFLGDSGGPLVCSNVAQGVVSYGDRMGTPPAVFTRISSF
LPWIRRTMR
Download sequence
Identical sequences E1BEQ4
ENSBTAP00000017607 ENSBTAP00000017607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]