SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017986 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017986
Domain Number 1 Region: 114-439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-83
Family G proteins 0.00000147
Further Details:      
 
Domain Number 2 Region: 660-828
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-57
Family Translational machinery components 0.0000196
Further Details:      
 
Domain Number 3 Region: 443-568
Classification Level Classification E-value
Superfamily Translation proteins 8.17e-35
Family Elongation factors 0.00034
Further Details:      
 
Domain Number 4 Region: 829-915
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.44e-26
Family EF-G/eEF-2 domains III and V 0.00025
Further Details:      
 
Domain Number 5 Region: 585-658
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.4e-17
Family EF-G/eEF-2 domains III and V 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017986   Gene: ENSBTAG00000013526   Transcript: ENSBTAT00000017986
Sequence length 972
Comment pep:known_by_projection chromosome:UMD3.1:19:45197098:45233617:-1 gene:ENSBTAG00000013526 transcript:ENSBTAT00000017986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEVDEDEDDDDVGDHDEDHPGMEVVLH
EDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLA
DLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVG
IKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLIL
SPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKA
PTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVC
KKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIE
VNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSEL
PKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVV
TFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLC
DELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPA
DCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSV
FHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
Download sequence
Identical sequences F1N6D5 L8I6F5
XP_004013039.1.66739 XP_005220899.1.76553 XP_005693998.1.57651 XP_005903403.1.15283 XP_005983756.1.78601 XP_012012879.1.54773 XP_012012880.1.54773 XP_012041607.1.66739 XP_019837248.1.53367 XP_019837249.1.53367 XP_020729053.1.74333 9913.ENSBTAP00000017986 ENSBTAP00000017986 ENSBTAP00000017986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]