SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018177 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018177
Domain Number 1 Region: 172-248,276-381
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000583
Family C-terminal domain of adrenodoxin reductase-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018177   Gene: ENSBTAG00000013678   Transcript: ENSBTAT00000018177
Sequence length 553
Comment pep:known_by_projection chromosome:UMD3.1:14:76149588:76178108:-1 gene:ENSBTAG00000013678 transcript:ENSBTAT00000018177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCRCSLAAHFRRNYSDTETEGEILNSLVQYFGDNLGQNVKAMPLVEETSLLEDSSV
TLPVVVIEIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILHSKLEEARHLSIVDQDLEYL
SEGLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHN
MEGSMLTISFGNWMELPGLKFKDWVSSKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFR
ENTYITSVSRLYRDQVDNDGQGRNISTQHLQIEKSKFAKRNWEIRGYQRVGDGSHIPFCL
FAENVALATGTLDSPGRLEIEGEDFPFVFHSMPEFGAAVSKGKLRGKVDPVLIVGSGLTA
ADAVLCAYNNNVPVIHVFRRRVTDPDLIFKQLPKKLYPEYHKVYHMMCTQSYSLDSDLLS
AYTSFPEHHVLAFKSDMKCILQSISGLKKIFRLSAAVVLIGSHPNLSFLKEQGCYLGHNS
SLPITCKGNPVEIDAYTYECVKEANLFALGPLVGDNFVRFLKGGALGVTRCLAIRQKKKK
HLFVERGGGDGIV
Download sequence
Identical sequences F1MJA0
ENSBTAP00000018177 ENSBTAP00000018177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]