SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018258 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018258
Domain Number 1 Region: 269-371
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000549
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0087
Further Details:      
 
Domain Number 2 Region: 32-137
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000301
Family Scavenger receptor cysteine-rich (SRCR) domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000018258
Domain Number - Region: 167-269
Classification Level Classification E-value
Superfamily SRCR-like 0.00392
Family Scavenger receptor cysteine-rich (SRCR) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018258   Gene: ENSBTAG00000013730   Transcript: ENSBTAT00000018258
Sequence length 495
Comment pep:known chromosome:UMD3.1:29:38005199:38026747:1 gene:ENSBTAG00000013730 transcript:ENSBTAT00000018258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQHLPLAALYLLELLVTSCLGGLKVEVQGLTMRLSGSGSRCQGRLEVSNGTEWYAVHS
QSWGQLSLYQVAPRQFLKLCQELQCRDPLLLSSSRYFKEVQFQKLIICHGQLGSFSNCSL
NRGRQVDSLALICLEPPRTTAPPTTSPPTTTPEPTAPPRFQLVAEPGGLRCAGVVEFYSG
GLGGTIGIEPQNDIKDLGQLICAALQCGSFLKPLPETEEAQTQKPEGQRPLPIRWEIQNP
KCTSLEQCFRKVQPWVGGQALGLICSDFQPKVQSRLVGGSDVCEGSVEVRSGKGQKWDTL
CDDSWAKGTARWEEVCREQQCGNVSSYRGLDPSEKTLGGFYCPPGILSRCHKLEEKKSHC
KRVFVTCQNSSRAGLGAGAVMSIILALLLLAVLLVVCGPLAYKKVVKKFRQKKQRQWIGP
TGMNQNMSFHRNHTVTVRSQVENATASHVENEYSQPPRNSQISAYPALEGALHRISTQPD
NSSDSDYELHGAQRL
Download sequence
Identical sequences P19238
ENSBTAP00000018258 9913.ENSBTAP00000018258 ENSBTAP00000018258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]