SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018363 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018363
Domain Number 1 Region: 44-201
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.19e-30
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 214-294
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.22e-25
Family GAS2 domain 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018363   Gene: ENSBTAG00000013822   Transcript: ENSBTAT00000018363
Sequence length 687
Comment pep:known_by_projection chromosome:UMD3.1:5:64841326:64856203:1 gene:ENSBTAG00000013822 transcript:ENSBTAT00000018363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTLIPFPQVWFGEDLPLSPRSPLTPRHGPGLADVCQYDEWIAVRHEATLLPMQEDLSIWL
NGLLGIEVKAERLLEELDNGVLLCQLIDVLQNMVKTCNSEEPVNFPMRKVPCKKDAASGS
FFARDNTANFLHWCRHIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVL
VKLEKEIELEETLLNTSGPEDSISIPKSCCQHEELHEAVKHIAEDPPCSCSHRFSIEYLS
EGRYRLGDKILFIRGKMLHGKHVMVRVGGGWDTLQGFLLKYDPCRILQFATLEQKILAFQ
KGVSIESVPDSPARTPQPPEMNPLSAVSMFQKQNSKLGTPVGIPRGKEKQVHLPAALPSA
SSLKGGNLAPRSVRSKLANSPAASSHLKLMSSKGITKKPQAPSNSASSSHASLNPVAFSR
AAPCVSESLRKGISSPSTPKTKRVPAQKSRDVPESTILPNKCSGKTEPKHLKHNHVPSRD
HAVSPSATHLNSSSKCPKLPKAHLHVRPNPSSFQSPAKVTTTSSKTVIRSLETRAQPHGR
APQAQKPKSALNLNQPLPISSVAPTKAAQKLKDKNMVSVAKKQPQNKSTSQKTGTSASRS
PGRTPLSIVSLPQSSAKTQPEPKSVQTATKSQCSAAGPPKSGKAPASTRKPPSSGKETVS
ADEKPSAKKKEDDDHYFVMTGSKKPRK
Download sequence
Identical sequences F1MIY4
ENSBTAP00000018363 ENSBTAP00000018363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]