SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018403 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018403
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily EF-hand 8.85e-50
Family Calmodulin-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018403   Gene: ENSBTAG00000013854   Transcript: ENSBTAT00000018403
Sequence length 148
Comment pep:known chromosome:UMD3.1:13:43507344:43508178:1 gene:ENSBTAG00000013854 transcript:ENSBTAT00000018403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKLSEEQVAEFKEAFDRFDKNKDGTISVQELGTVMQEVGLKLSEAELKKLISQLDTDK
NGSISFQEFLEAMAAGLQTSDTEGLREIFRAFDQDDDGYISVDELRQATSQLGEKVSQDE
LDAMIREADVDQDGRVNYEEFVRILTQN
Download sequence
Identical sequences A4IFQ6 L8I8W7
ENSBTAP00000018403 ENSBTAP00000018403 9913.ENSBTAP00000018403 NP_001091518.1.59421 NP_001091518.1.76553 XP_005901023.1.15283 XP_010834675.1.44457 XP_019828868.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]