SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018405 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018405
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily SH2 domain 8.21e-22
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 269-447
Classification Level Classification E-value
Superfamily Ras GEF 0.0000000000000288
Family Ras GEF 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018405   Gene: ENSBTAG00000013857   Transcript: ENSBTAT00000018405
Sequence length 523
Comment pep:known chromosome:UMD3.1:7:18946166:18959402:1 gene:ENSBTAG00000013857 transcript:ENSBTAT00000018405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVPQDGEDFVGQPWYHGPLSRQKAEDLLQQDGDFLVRASKSRGGHPVISCRWRGSALHF
EVLRVALRPRPGRPTALFQLEDERFPSLPALVRSYVIGQRPLSQATGAVASRPVPRQGLI
RRSFSEDTLPDDPARTEPLRDRKRSDSQPAGLEHMWRSPEDPPGPGASTVPASGLPRTGS
DPVILKTPVPLGSVADSLRASDGQLHAKAPTKPPRTPSLLLPDASGRPPTYCELVPRVLR
FQGPPPGHSCPESEVPWWEAEEEKEEDRCFARPQAEVSFCLPDTPSCLLGSQNRPLEPEV
LHTLRGLFLEHHPGSTALHLLLVDCQATGVLGVTKAQRGAMGVASGLELLTLPHGHRLRL
ELLERLETLALAGALAVLGCAGPLEERAAALRGLVELAVALRPGAVGDLPGLAAVMGALL
MPQVSRLERTWRHLRRSHTEAALAFEQELKPLMRSLNEGAGPSDPGEVALPHVAPAARLL
EGEELPGPLDESCERLLRTLHRARQTARDAPRFREAVARRLRG
Download sequence
Identical sequences F1MID1
ENSBTAP00000018405 ENSBTAP00000018405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]