SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018411 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018411
Domain Number 1 Region: 164-312
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-45
Family Dual specificity phosphatase-like 0.00000243
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.06e-24
Family Cell cycle control phosphatase, catalytic domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018411   Gene: ENSBTAG00000013863   Transcript: ENSBTAT00000018411
Sequence length 367
Comment pep:known chromosome:UMD3.1:20:4449109:4452189:-1 gene:ENSBTAG00000013863 transcript:ENSBTAT00000018411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMEVVSLDAGGLRTLLRERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDCAKRDGTLALAAGALCREARSAQIFL
LKGGYEAFSASYPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDCSTSTTTVFNFPVSIPVHPTNSALSYLQSP
ITTSPSC
Download sequence
Identical sequences F1MI99
ENSBTAP00000018411 ENSBTAP00000018411 XP_012009397.1.54773 XP_017921209.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]