SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018426 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018426
Domain Number 1 Region: 305-466
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-43
Family Dual specificity phosphatase-like 0.00093
Further Details:      
 
Domain Number 2 Region: 270-317
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000327
Family DEK C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018426   Gene: ENSBTAG00000031590   Transcript: ENSBTAT00000018426
Sequence length 649
Comment pep:known_by_projection chromosome:UMD3.1:29:45870040:45877738:1 gene:ENSBTAG00000031590 transcript:ENSBTAT00000018426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVTVSRSPPASGHSTPVGPTQDPVSQRRSRLQRRQSFAVLRGAVLGLQDGGDDGDASR
PSPEPAEEPPGEGQPHGDQTDNGHGPPSPGRQEQSQHLCLMVELLRPQDDIRLAAQLEAA
RAPRLRYLLVVSTREGLSRDETVLLGVDFPDSSSPSCTLGLVLPLWSDTQVYLDGDGGFS
VTSGGQSRIFKPVSIQTMWATLQVLHQACEAALSSGLVPGGSALAWASHYQDRLSSDQSC
LNEWMAMADLESLRPPCVESSRPSEQEQMEQAIRAELWEVLDTSDLDNVTSKEIRQALEL
RLGCPLQQYRDFIDNQMLLLMAQQDRASRIFPHLYLGSEWNAANLEELQRNRVSHILNMA
REIDNFYPERFTYHNVRLWDEESAQLLPHWKETHRFVEAARAQGTRVLVHCKMGVSRSAA
TVIAYAMKQYGWSLEQALRHVQELRPIARPNPGFLRQLQTYQGILTASRQSHVWEQKAGG
ASPEEPLAPEVSTPFPPLQPEPGGSGELSVMGSEDSQAAPKEAPGSRPRINLRGVMRSIS
LLEPPSELDSPSGDADLPEVFSSKESSDEDPPQPFPQPSSAKGGRQVHRGPWPALKSRQS
VAALNSAALVASRTRAFQEQGEAGCASTPRHQKIVRQASVDSSGEEGEV
Download sequence
Identical sequences F1MI92
9913.ENSBTAP00000018426 ENSBTAP00000018426 ENSBTAP00000018426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]