SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018473 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018473
Domain Number 1 Region: 10-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.18e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000525
Further Details:      
 
Domain Number 2 Region: 367-489
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.3e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018473   Gene: ENSBTAG00000013912   Transcript: ENSBTAT00000018473
Sequence length 497
Comment pep:known chromosome:UMD3.1:5:68239611:68302678:1 gene:ENSBTAG00000013912 transcript:ENSBTAT00000018473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGSKDLPEPYDYDLIIIGGGSGGLAAAKEAAKYDKKVMVLDFVTPTPLGTRWGLGGTCV
NVGCIPKKLMHQAALLGQALRDSRNYGWNVEETVKHDWERMTEAVQNHIGSLNWGYRVAL
REKKVTYENAYGEFVGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISS
DDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
QEHGIKFIRQFVPIKVEQIEAGTPGRLRVIAKSTDSDQTIEGEYNTVLLAIGRDACTRKI
GLENVGVKINEKTGKIPVTEEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGG
STVKCDYENVPTTVFTPLEYGSCGLSEEKAVEKFGEENVEVYHSYFWPLEWTIPSRDNNK
CYAKVVCNIKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKDQLDSTIGIHPVCAEVFT
TLSVTKRSGGNILQTGC
Download sequence
Identical sequences G1K1Q2
XP_005899134.1.15283 XP_010851712.1.44457 XP_010851713.1.44457 ENSBTAP00000018473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]