SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018600 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018600
Domain Number 1 Region: 30-156
Classification Level Classification E-value
Superfamily PH domain-like 2.07e-23
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 508-580
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000137
Family SH2 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018600   Gene: ENSBTAG00000013996   Transcript: ENSBTAT00000018600
Sequence length 589
Comment pep:known_by_projection chromosome:UMD3.1:6:108023960:108034231:1 gene:ENSBTAG00000013996 transcript:ENSBTAT00000018600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVLCPVPAGRARGWRAFVIVSAVGFMAAEETHWPVPMKAIGAQNLLTMPGGVAKAGYL
HKKGGTQLQLLKWPLRFVVIHKRCIYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSNNV
FPFKIIHVSKKHRTWFFSASSEDERKSWMALLRKEIGHFQEKKELPLDASDSSSDTDSFY
GAIERPVDISLSPHPTDSEDYEHDDEDDSYLEPDSPEPGRPEDPLIHPPAYPPPPVPTPR
KPVFSEVPRAHSFTSKGPGPLLPPPPPKRGLPDTGPAPEDSRREPPPLRWVEPGSRVPAV
SRRMSDPPSNILPPGPGLRKAPCFPENSSPSLEPRIPAHGVSPSSTATAASRNCDKLKSF
HLSPRGTPAPEPPPVPANKPKFLKMVEESPPGEAARPGSRVPPVAPRPPPLKLPMPEAAD
RPPVLPRPEKPALPHLQRSPPDGQSFRSFSFEKPRKPVQTDTSQADAGGEGSDDDYEKVP
LPSSVFINTTESCEVERLFKATSPRGVPQDGLYCIRNSSTKSGKVLVVWDETSSKVRNYR
IFEKDSKFYLEGEVLFVGVGSLVEHYHTHVLPGHQSLLLQHPYGYARPR
Download sequence
Identical sequences F1MQD5
ENSBTAP00000018600 ENSBTAP00000018600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]