SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018797 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000018797
Domain Number - Region: 55-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000159
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018797   Gene: ENSBTAG00000014141   Transcript: ENSBTAT00000018797
Sequence length 282
Comment pep:known chromosome:UMD3.1:27:6674973:6683937:-1 gene:ENSBTAG00000014141 transcript:ENSBTAT00000018797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGPRGGLLTQPAAARPKTRSVLPCQAAPNGQKPKKCLVYPHPPKSSRLSRSVLRWLQ
SLDLTFFPRNISRDFSNGFLIAEIFTTYYPWDLKLSSFKNGTSLKVKLDNWAQLEKFLAR
KKLKLPKELIHGTIHCKAGVPEILIQEVYTLLTHREIKSIQEDLVNFTDYSYQMQLPLVP
RSTASKSIKDNIRLSELIGNPNKLNNELKVEFLFLLQMLQRKLSRKLNPKWFAVKPTVGE
STLDHRPAKASGNKSNSVVSKERPVPVCSKQVIESVHLKKLR
Download sequence
Identical sequences Q5MB00
ENSBTAP00000018797 NP_001011677.1.59421 NP_001011677.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]