SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018804 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018804
Domain Number 1 Region: 20-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.95e-45
Family Eukaryotic proteases 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018804   Gene: ENSBTAG00000014147   Transcript: ENSBTAT00000018804
Sequence length 327
Comment pep:known chromosome:UMD3.1:18:26202382:26215285:-1 gene:ENSBTAG00000014147 transcript:ENSBTAT00000018804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMRRALLLLLYVSHASASCGIQKSNIAVTSEEGLVEEQEFPWVVSLQDSQYTHLTFGS
ILSEFWILSIASTFQNRKDAVAIIGIAKMDAKLIAHEEYPINTIIIHEDFDNKTMRNNIA
LLKTDTAMQFNSLVRPICFLGRKLNRPPVLMNCWVAGWNPTSATGNHMTMSILRKISVKD
IDSCPLNIEQKTGCGNHLEMETNAVCLGDPGNPMMCQLKEMSLWVLRGILSQGGEKCPGL
FLYIRVEDYSDWITSKTRKTSSPLSSFHHWENPSPLPSYSSRDLVTQRKQAGLSQLVWPR
LSFQEQESSQWARGLPGTLYHMKRLRT
Download sequence
Identical sequences A5PJD4
ENSBTAP00000018804 9913.ENSBTAP00000018804 ENSBTAP00000018804 NP_001092514.1.59421 NP_001092514.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]