SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018947 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018947
Domain Number 1 Region: 322-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.16e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000118
Further Details:      
 
Domain Number 2 Region: 145-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.53e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000793
Further Details:      
 
Domain Number 3 Region: 606-712
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.5e-28
Family Anticodon-binding domain of Class II aaRS 0.001
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000109
Family TGS domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018947   Gene: ENSBTAG00000014261   Transcript: ENSBTAT00000018947
Sequence length 723
Comment pep:known chromosome:UMD3.1:20:40349625:40373064:-1 gene:ENSBTAG00000014261 transcript:ENSBTAT00000018947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEQASSPSAKMGDEEKPVGAGEEKQKEGSKKKNKEGSGDGGRAELNPWPEYINTRLEM
YNKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNKAVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKSDMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFI
RSEYRKRGFQEVVTPNIYNSRLWVTSGHWEHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRVADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYSIFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNDFGEKWELNPGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKKPVIIHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHNAKFMVDIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHGERTISETIERLQQLKHSRSKQAE
EEF
Download sequence
Identical sequences Q3ZBV8
9913.ENSBTAP00000018947 ENSBTAP00000018947 NP_001029542.1.59421 NP_001029542.1.76553 XP_005887779.1.15283 XP_010852133.1.44457 ENSBTAP00000018947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]