SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019098 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019098
Domain Number 1 Region: 2-250
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1e-81
Family Eukaryotic proteases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019098   Gene: ENSBTAG00000038568   Transcript: ENSBTAT00000019098
Sequence length 281
Comment pep:novel chromosome:UMD3.1:25:2257125:2268388:1 gene:ENSBTAG00000038568 transcript:ENSBTAT00000019098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCGIQGIQVRVVGGNEAKLGRWPWQGSLRWNKVHSCGASLLNRRWALSAAHCFEKNSYPS
EWSVQFGELSATPSIWSLRAFLRRYGVQDIITFSQFRKNFQHDIALVKLSSPVTFNKHVQ
PVCVTSSSLEFKNRNDCWVTGWGNIGERQTPQLLPPYNLREVQVSIINKSRCSYLFQQPL
YRRNINHGMICAGSEDGDADSCKGDSGGPLVCEKNGRWIQIGIVSWGVGCGRRNRPGVYT
NVSHYFSWIQLLTARSTPRPDPSWLLLPLALLWTLLLLQMA
Download sequence
Identical sequences F1N5M6
ENSBTAP00000019098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]