SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019111 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019111
Domain Number 1 Region: 22-164
Classification Level Classification E-value
Superfamily EF-hand 4.36e-43
Family Calmodulin-like 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019111   Gene: ENSBTAG00000014373   Transcript: ENSBTAT00000019111
Sequence length 167
Comment pep:known chromosome:UMD3.1:7:92290239:92307723:-1 gene:ENSBTAG00000014373 transcript:ENSBTAT00000019111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLALRNDLVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFD
VKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISL
RNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Download sequence
Identical sequences A0A250YAZ3 F1N547
9913.ENSBTAP00000019111 ENSBTAP00000019111 ENSBTAP00000019111 XP_004009125.1.66739 XP_005683484.1.57651 XP_005907594.1.15283 XP_005955078.1.78601 XP_006080302.1.26621 XP_010830211.1.44457 XP_011975173.1.54773 XP_019820975.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]