SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019803 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019803
Domain Number 1 Region: 44-261
Classification Level Classification E-value
Superfamily EF-hand 3.47e-63
Family Penta-EF-hand proteins 0.0000000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019803   Gene: ENSBTAG00000014872   Transcript: ENSBTAT00000019803
Sequence length 263
Comment pep:known chromosome:UMD3.1:18:46987527:46994449:1 gene:ENSBTAG00000014872 transcript:ENSBTAT00000019803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLVNSFLKGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGTAMRILGGV
ISAISEAAAQYNPEPVPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILN
KVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAVYKQFDVDR
SGTIGSSELPGAFEAAGFRLNEHLYNMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKS
LDKDGTGQIQVNIQEWLQLTMYS
Download sequence
Identical sequences P13135
ENSBTAP00000019803 9913.ENSBTAP00000019803 ENSBTAP00000019803 NP_776686.1.59421 NP_776686.1.76553 XP_019834708.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]