SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020006 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020006
Domain Number 1 Region: 279-549
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-84
Family Protein kinases, catalytic subunit 0.000000000266
Further Details:      
 
Domain Number 2 Region: 168-308
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-38
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 3 Region: 108-193
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020006   Gene: ENSBTAG00000015026   Transcript: ENSBTAT00000020006
Sequence length 1182
Comment pep:known_by_projection chromosome:UMD3.1:16:61897894:61992970:-1 gene:ENSBTAG00000015026 transcript:ENSBTAT00000020006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQVGRVGEAPGLQQSQPRGIRGSSAARPSGRRRDLVGRTAEAGFNIFTQHDHFASCLE
DGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAAAASSVVPYLPRLPLLPSKTRTLKKQGENKENIEGAQDATE
DSASSSAPGFIRSAQAPSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHAEGFSLTPAQQEASLVPPKCYGG
SFAQRNLCNDDGGGGGGSGAAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPR
SNSTSSVSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDTLPKKSEEG
AAPTRERPKAKLLPRGGTALPLRTPSGDPATTEKDSPGLGVAGVAAAPKSKERNGGARLG
MAGVPEDGEQTGWASPAKTAAVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKL
LSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSVCSDSTEEPAAPTAVQPKSETQE
GGKKAAPGAVPTSGKAGRPVMPPPQVPLPTSSGSPAKMANGTAGTKVALRKTKQAAEKIS
ADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAV
SKLELSLQELQVSSAAAGVPGANPVLNNLLSCVQEISDVVQR
Download sequence
Identical sequences F1MWH8
ENSBTAP00000020006 NP_001137327.1.59421 NP_001137327.1.76553 XP_019832258.1.53367 ENSBTAP00000020006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]