SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020079 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020079
Domain Number 1 Region: 226-484
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.07e-51
Family Glycerophosphoryl diester phosphodiesterase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020079   Gene: ENSBTAG00000031777   Transcript: ENSBTAT00000020079
Sequence length 610
Comment pep:known chromosome:UMD3.1:15:55392275:55483132:-1 gene:ENSBTAG00000031777 transcript:ENSBTAT00000020079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLY
FWWEVHNDYDEFNWYLYNRMGYWSDWSVPILMTTAAAFTYIAGLQVLALCHIAVGQQMNL
HWLHKIGLVAILVATVVAMSAVAQLWEDEWEVLLISLQGTAPFLHVGALVAITALSWIVA
GQFARAERSSSQIAILGTFFTVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLA
PEHTLMSFRKALEQKLYGLQADVTISLDGVPFLMHDATLRRTTNVEEEFPELARRPASML
NWTILQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICRLVELLELAKGNATLLLNLR
DPPREHPYRSSFLNITLEALLSSGFPQHQVLWLPNRQRPLVRKVAPGFQQMSGSKEAAAS
LRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHT
LSQVPSPLWIMPPDEYCLLWVTADLISFTLIVGIFVLQNYHLIRWRLGGIRSYNPEQIML
SAAVHRTSRDVSIMKEKLIFSEISDGMEVSDELSVCSDNSYDSYANSATTPVAPRGSGSR
AKTLTDRSGR
Download sequence
Identical sequences A7MAZ1
NP_001094611.1.59421 NP_001094611.1.76553 XP_005216306.1.76553 XP_010810995.1.76553 XP_010810996.1.76553 XP_010810997.1.76553 9913.ENSBTAP00000020079 ENSBTAP00000020079 ENSBTAP00000020079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]