SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020121 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020121
Domain Number 1 Region: 10-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-79
Family Eukaryotic proteases 0.0000000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020121   Gene: ENSBTAG00000030482   Transcript: ENSBTAT00000020121
Sequence length 246
Comment pep:known chromosome:UMD3.1:18:57404802:57413315:-1 gene:ENSBTAG00000030482 transcript:ENSBTAT00000020121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVKMLVIALVLVAAAQAEEKDKVLHGGPCEQTSHPYQAALYTAGHLLCGGVLIHPLWVL
TAAHCKKPNLQVFLGKHNLQQREFFQEESSVIRTVAHPGYNAATHDQDIMLLRLSRPPRL
SDHIQPLALERDCSANHTSCHILGWGKMADGEYPDTIQCAYVHLVSREKCDHAYPGQITQ
NMVCAGDEKHGKDSCQGDSGGPLVCGDRLRGLVSWGNVPCGSKEKPGVYTDVCRYGHWIQ
RVIQAN
Download sequence
Identical sequences A6QQ95
NP_001094610.1.59421 NP_001094610.1.76553 XP_005219363.1.76553 XP_015313657.1.76553 ENSBTAP00000020121 9913.ENSBTAP00000020121 ENSBTAP00000020121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]