SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020123 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020123
Domain Number 1 Region: 9-248
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-79
Family Eukaryotic proteases 0.0000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020123   Gene: ENSBTAG00000030483   Transcript: ENSBTAT00000020123
Sequence length 251
Comment pep:known chromosome:UMD3.1:18:57419935:57425155:-1 gene:ENSBTAG00000030483 transcript:ENSBTAT00000020123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPLVILLLTFALGSVAQEDQGNKSGEKIIDGVPCPRGSQPWQVALLKGSQLHCGGVLL
NEQWVLTAAHCKMNEYNVHMGSVRLVGGQKIKATRSFRHPGYSTQTHANDLMLVKLNGRA
KLSSSVKKVNLPSHCDPPGTMCTVSGWGTTTSPDVTFPGQLMCTDVKLISPQDCRKVYKD
LLGDSMLCAGIPNSRTNACNGDSGGPLMCKGTLQGVVSWGSFPCGQPNDPGVYTQVCKYV
NWIKETMRRYR
Download sequence
Identical sequences Q08D90
NP_001068724.1.59421 NP_001068724.1.76553 9913.ENSBTAP00000020123 ENSBTAP00000020123 ENSBTAP00000020123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]