SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020127 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020127
Domain Number 1 Region: 26-256
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.96e-80
Family Eukaryotic proteases 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020127   Gene: ENSBTAG00000015128   Transcript: ENSBTAT00000020127
Sequence length 259
Comment pep:known chromosome:UMD3.1:18:57431504:57436686:-1 gene:ENSBTAG00000015128 transcript:ENSBTAT00000020127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPSPAAVWIWMLLLLLLESQAGHVRAQENKVLEGKECKPHSQPWQTALFQGVRLICGG
VLIEDNWVLTAAHCQKKKYVVRMGEHSLKKKDESEQERAVARSIPHPCYNNSKNDHSYDM
MLIQLRGRVSLGPKVKPIKLADHCPQVGQKCTISGWGTVTSPREKFPDTLNCAEVKIIPQ
DQCEKAYPGQVTDSMVCASDSSGADTCQGDSGGPLVCNGVLHGITSWGSDPCGRPEKPGV
YSKVCRSLDWIKKTIGRRG
Download sequence
Identical sequences E1BKC5
9913.ENSBTAP00000020127 NP_001180118.1.59421 NP_001180118.1.76553 XP_010813403.1.76553 ENSBTAP00000020127 ENSBTAP00000020127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]