SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020148 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020148
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily EF-hand 2.26e-27
Family S100 proteins 0.0000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020148   Gene: ENSBTAG00000015145   Transcript: ENSBTAT00000020148
Sequence length 102
Comment pep:known chromosome:UMD3.1:3:18768796:18770416:1 gene:ENSBTAG00000015145 transcript:ENSBTAT00000020148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKVSSPTETERCIESLIAVFQKHAGRDGNNSKLSKAEFLIFMNTELGAFTKNQKDPGVLD
RMMKKLDLNSDGQLDFQEFLNLIGGLAIACHESFIKSASSQK
Download sequence
Identical sequences F1MX83
ENSBTAP00000020148 ENSBTAP00000020148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]