SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020161 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020161
Domain Number 1 Region: 38-138
Classification Level Classification E-value
Superfamily SH2 domain 2.77e-29
Family SH2 domain 0.00000579
Further Details:      
 
Domain Number 2 Region: 248-314
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-22
Family SH3-domain 0.0000377
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000304
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020161   Gene: ENSBTAG00000015157   Transcript: ENSBTAT00000020161
Sequence length 316
Comment pep:known_by_projection chromosome:UMD3.1:5:111824690:111844169:1 gene:ENSBTAG00000015157 transcript:ENSBTAT00000020161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIAKFDFMASGEDELGFHAGDVLKILSNQGEWFKAELGSQEGYVPKNFIEIEFPEWFH
EGLSRHQAESLLMGKELGCFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRKNSISKQKQIFLRDRTREEQGQRGNSLDRRSQGGHPLSGAVGEEIRP
SMNRKPSDHPLLPPSQYPPAPLPAQQRYMPQHHFNQERRGASLDINDGPCGLGMSTEMNA
ALMHRRHTDPVQLQVAGRVRWARALYDFEALEDDELGFRCGEVVEVLDSSNPSWWTGRLH
NKLGLFPANYVAPMIR
Download sequence
Identical sequences E1BKA6 L8IF49
9913.ENSBTAP00000020161 ENSBTAP00000020161 ENSBTAP00000020161 NP_001179489.1.59421 NP_001179489.1.76553 XP_005207450.1.76553 XP_005207451.1.76553 XP_005899517.1.15283 XP_010832041.1.44457 XP_010832042.1.44457 XP_010832043.1.44457 XP_019817398.1.53367 XP_019817399.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]