SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020194 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020194
Domain Number 1 Region: 123-365
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.95e-31
Family Eukaryotic proteases 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020194   Gene: ENSBTAG00000015177   Transcript: ENSBTAT00000020194
Sequence length 375
Comment pep:known chromosome:UMD3.1:29:8788703:8797308:-1 gene:ENSBTAG00000015177 transcript:ENSBTAT00000020194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTPGHPIFLLLLLRAIGQVSPYSTHWKPTWPAYRLPVVLPQSTFNLAKPDFGAEAKLE
VSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYVLRSGEEQSSGKSRRK
RQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYVKGT
QKLRVGFLKPKFKDGRGANDSHSALPEKMKFQWIRVKRTHVPKGWIKGNANDIGMDYDYA
LLELKKPHKRKFMKIGVSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVQDETYDLLYQQ
CDAQPGASGSGVYVRMWKRQQQKWERKIIGIFSGHQWVDVNGSPQDFNVAVRITPLKYAQ
ICYWIKGNYVDCREG
Download sequence
Identical sequences Q1LZE9
9913.ENSBTAP00000020194 ENSBTAP00000020194 NP_001073775.1.59421 NP_001073775.1.76553 XP_005226732.1.76553 ENSBTAP00000020194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]