SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020205 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020205
Domain Number 1 Region: 431-604,631-699
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000118
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 84-316
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000294
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000020205
Domain Number - Region: 359-403
Classification Level Classification E-value
Superfamily EF-hand 0.00546
Family Parvalbumin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020205   Gene: ENSBTAG00000015183   Transcript: ENSBTAT00000020205
Sequence length 751
Comment pep:known_by_projection chromosome:UMD3.1:29:47037688:47067971:1 gene:ENSBTAG00000015183 transcript:ENSBTAT00000020205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTLEESEPLLSRARGGSGRDCPRGVLTCSSVQESPGAAARRDLCLDQAVVLIEDAIQY
RSINHRMDARSLWLYRWYYSSSSQWILSFTIFLILALAFVETPSSLTRTSDVRYRPAPWE
PPCGLTEGVEALCLLVFVADVSVKSYLIGWAQFRRNPWLLAYLVVLVASLLDWTVSLSLV
CQEPLRVRRLLRPFFLMQNSSMMKKTLKCIRRSLPEMASVGLLLAVHLCLFTVFGMLLFT
GEKDAGQDRERLTYFFNLPEALTTLLVLLTTANNPDVMIPVYSRNRAYAIFFIAFTLIGS
LFLMNLMTAIIYNQFRGYLMMSLQTSLLRRRLGTRAAYEVLSSVTAEGEAHPKRLGVKPE
DFLQVLQKVQLDSDHKQAITEKLHSRGDGLLSTDEFQKLFYEFDKRVIKEHPPRPEYQSP
FLRSTQFLFGHHYFDYLGNLMALGNLVTICVFLVLDAHVLPKDRDDFVLGILNCIFILYY
LLEMLLKVFSLGLQGYLSYSSNVFDGLLTIVLLVLEISTLAEYGFPHRGWKPATLGLLSL
WDMTRLVNVLIVFRFLRIIPSMQLMSLVASTILDLIKNMRAFGGILVVIYYVFAIIGISL
FQGVIVAPRNSSLASVNGSAPCGSFEQLEYWPNNFDDFAAALVTLWDVMIVNNWQVFLDA
FRRYAGPWSEVYFVLWWLVSSVIWVNLFLALILENFLHKWDRRSHLQSFTQELEDTSEMT
QELPFRDVLEEPTEEELVEKLSRHPHLQLCR
Download sequence
Identical sequences E1BIB9
9913.ENSBTAP00000020205 ENSBTAP00000020205 ENSBTAP00000020205 NP_001179380.1.59421 NP_001179380.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]