SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020226 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020226
Domain Number 1 Region: 49-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.19e-41
Family FAD-linked reductases, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020226   Gene: ENSBTAG00000015200   Transcript: ENSBTAT00000020226
Sequence length 463
Comment pep:known chromosome:UMD3.1:10:43211978:43265008:-1 gene:ENSBTAG00000015200 transcript:ENSBTAT00000020226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPALRYLGSVCGRARGIFPGGFSAAHTPASGKSRLLCQGGRRASTSSFDIVIIGGGIVG
LASARALILRHPALSIGVLEKEKNLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALI
YEYCNQKGISYKQCGKLIVAVEQEEIPRLQALYERGLQNGVQGLRLIQQEDIKKKEPYCR
GLMAIDCPYTGIVDYRQVAFSFAKDFQEAGGSVLTNFEVEDIEMARESPSRSKDGMKYPI
VIRNTKGEEVRCQYVVTCAGLYSDRISELSGCNPNPRIVPFRGDYLVLKPEKRYLVKGNI
YPVPDSRFPFLGVHFTPRMDGNIWLGPNAILAFKREGYRPFDFSARDIMDIIIKSGLIKL
VFQNFSYGVNEMYKACFLSATVKHLQKFIPEITISDVLRGPAGVRAQALDRDGNLIEDFV
FDGGVGDIGNRILHVRNAPSPAATSSLAISGMIADEVQQRFKL
Download sequence
Identical sequences A7MBI3
ENSBTAP00000020226 ENSBTAP00000020226 NP_001094560.1.59421 NP_001094560.1.76553 XP_019824200.1.53367 9913.ENSBTAP00000020226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]