SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020230 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020230
Domain Number 1 Region: 230-366
Classification Level Classification E-value
Superfamily SH2 domain 4.27e-27
Family SH2 domain 0.00044
Further Details:      
 
Domain Number 2 Region: 116-166
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-21
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 3 Region: 197-272
Classification Level Classification E-value
Superfamily SH3-domain 2.58e-19
Family SH3-domain 0.000031
Further Details:      
 
Domain Number 4 Region: 5-60
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-18
Family SH3-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020230   Gene: ENSBTAG00000015205   Transcript: ENSBTAT00000020230
Sequence length 376
Comment pep:known chromosome:UMD3.1:11:45780703:45829966:-1 gene:ENSBTAG00000015205 transcript:ENSBTAT00000020230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNIKDTLGLGRTRRKTSARDASPTPSTDAEFPANGGGADRIYDLSIPAVVKF
AYAAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQVGWFPSNYVLEELDEAAGDAPGGS
SLRPGATLSNGQGARALQVVQTLYPFSSVTEEELNFDKGETMEVIEKPENDPEWWRCRNA
RGQVGLVPKNYVVVLSEGPAPHAGSGPAGPARAGRFAGREWYYGNVTRHQAECALNARGV
QGDFLVRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYKKAPI
FTSEHGEKLYLVRALQ
Download sequence
Identical sequences A6H720 L8IX09
9913.ENSBTAP00000020230 ENSBTAP00000020230 NP_001092506.1.59421 NP_001092506.1.76553 XP_005212836.1.76553 XP_005890040.1.15283 XP_006056038.1.26621 XP_006056039.1.26621 XP_006056040.1.26621 XP_010832424.1.44457 XP_010832426.1.44457 XP_019825804.1.53367 ENSBTAP00000020230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]