SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020324 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020324
Domain Number 1 Region: 474-565
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000108
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020324   Gene: ENSBTAG00000015276   Transcript: ENSBTAT00000020324
Sequence length 602
Comment pep:known chromosome:UMD3.1:19:53023436:53041077:-1 gene:ENSBTAG00000015276 transcript:ENSBTAT00000020324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPMSPMKPPKGFAPMSCCWSTETMQKWLPFLGWLPDYTWYALKMDFIAGISVGLTVIP
QALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEPAYAV
LLAFLTGCIQLGMGFLRLGLLLDFISCPVIKGFTSAAAIIIGFGQIKNLLGLQHIPRQFF
LQVYYTFHNIGETRVGDAVLGLVCMVLLLVLKLMRDHVPPVHPEMPTGVRLSHGLVWTAT
TARNALVVSFAALVAYSFQVTGYQPFVLTGKTPEGLPDAHIPPFSVTTANGTISFTEMVQ
GMGAGLVVVPLMGLLESIAVAKSFASQNNYRINSNQELLALGFTNILGSLFSSYPVTGSF
GRTAVNAQSGVCTPAGGLMTGALVLLSLDYLTSLFYYIPKSALAAVIIMAVVPLFDTKIV
KTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGTLVSVLILLHSVARPKIQVSEGPMLVLQ
PASGLHFPAIETLREALLSRALETSPPRSVALDCTHICSIDYTVVLGLGELLEDFHKRGA
TLALIGLQVPVLRVLLSADLKGVLYFCTLEEAEKYLKQEPGTQPYNGSEDSVPEHKIALL
KA
Download sequence
Identical sequences Q58DD2
ENSBTAP00000020324 NP_001014866.1.59421 NP_001014866.1.76553 ENSBTAP00000020324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]