SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020359 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020359
Domain Number 1 Region: 360-646
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020359   Gene: ENSBTAG00000015311   Transcript: ENSBTAT00000020359
Sequence length 655
Comment pep:known chromosome:UMD3.1:5:42837597:43112731:1 gene:ENSBTAG00000015311 transcript:ENSBTAT00000020359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAVGFPALCLLLSLHAAGCLAKNNDHFLAIRQKKSGKPAFIYHHSQDIEKSLDIAPQK
IHKHNYHSSSEAQIGRHHQIVNSAFPKPAYDPSLNLLAMAGQDLEVENRPVPAANVIVVT
LQMDVNRLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKNSVELFVSPINRKAGFSDAL
PSEEVLRSLNINVLHQSLSQFGITDVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKEKFQLSLRQDKEKNQEIHLSPIVLQPAHSEDKTANSMVQPEQAPKVLS
VVVDPQGRYTPEIKATTSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAIPTP
REKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYK
TILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQ
EDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTVRNLVLKQGSHTQ
RVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASAGRGPVVVHCSAGIGRTGCFIATS
IGCRQLREEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
Download sequence
Identical sequences A5PKF8
ENSBTAP00000020359 NP_001106732.1.59421 NP_001106732.1.76553 ENSBTAP00000020359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]