SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020433 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020433
Domain Number 1 Region: 206-323
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 568-724
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-21
Family Ras GEF 0.011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000020433
Domain Number - Region: 329-366
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 0.0936
Family Aminoacid dehydrogenases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020433   Gene: ENSBTAG00000015375   Transcript: ENSBTAT00000020433
Sequence length 860
Comment pep:known chromosome:UMD3.1:11:98435180:98467957:-1 gene:ENSBTAG00000015375 transcript:ENSBTAT00000020433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGTKKASKKFKFFKFKGFGSLSNLPRSFTLRRSLAPNSIRPQVEADTFDATQDDMVTV
PKSPPAYARSSDMYSHMGTMPRPSIKKAQGKQATQKAQEVGPEPQVVPRSLPDPPGLEAA
EKVVPGTIASREDTPTVGPNPSAVEVDPTRKPEDARPDTEEGRDPKNVPSERATAEPEAG
GDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDF
LIRDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYH
VGSRKAVSEQSGAIIYCPVNRTFPLRYLEACYGLGQGGGKAASPASPSGPKGSHMKRRSV
TMTDGLTADKVTRSDGCPTSTSLPHPRESIRNCALSMDQIQDLHSPMSPISESPSSPAYS
TVTRVHAAPAAPSATALPASPVTRRSSEPQLCPGSVPKPHGESDKGPYSSPSHTLCKASP
SPSLSSYSDPDSGHYCQLQPPVRGSREWAAAEASGRQARSYGEKLKELSENGASEGDWGR
TFTVPVVEATSSFNPATFQSLLIPKDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCL
VARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAMDILGCTGSAEE
RAALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQIARLEQTWVTLRQRHTEGAILYEK
TLKPFLKSLNEGKEGPPLSNTTFPHILPLITLLECDSAPAEGPEPWGSTEHGVEVVLAHL
EAARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSSQARRYEKF
DKVLTALSHKLEPAIRSSEL
Download sequence
Identical sequences A5D7L2
NP_001091508.1.59421 NP_001091508.1.76553 ENSBTAP00000020433 9913.ENSBTAP00000020433 ENSBTAP00000020433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]