SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020482 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020482
Domain Number 1 Region: 144-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-121
Family Transglutaminase core 0.0000000116
Further Details:      
 
Domain Number 2 Region: 2-142
Classification Level Classification E-value
Superfamily E set domains 1.99e-43
Family Transglutaminase N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 604-701
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.07e-24
Family Transglutaminase, two C-terminal domains 0.00066
Further Details:      
 
Domain Number 4 Region: 485-602
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.14e-24
Family Transglutaminase, two C-terminal domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020482   Gene: ENSBTAG00000015412   Transcript: ENSBTAT00000020482
Sequence length 706
Comment pep:known_by_projection chromosome:UMD3.1:21:55553635:55579813:-1 gene:ENSBTAG00000015412 transcript:ENSBTAT00000020482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALELRSVDLQSAKNNQEHHTQEMGLQRLIVRRSQSFTIQLHFNRPFHSKKDSITFVAET
GPAPKELLGTRATFLLTQDRQGKGWSASDFTVHANSLDVSLFTPPSAVIGSYSLKMEISQ
GPSHSTTHPLGTFILLFNPWSAEDDVYLPSETLLQEYIMMDYGFVYKGHERFITPWPWNY
GQFEEDIIDICFEILNKSLYFLKNPSKDYSQRNDVVYICRVVSAMINSNDDSGVLQGNWG
EDYSRGVSPLEWTGSVAILRQWAARGGQPVKYGQCWVFAAVMCTVMRCLGVPTRVVSNFR
SAHNSDANLTIDTYYDQHAEMLPTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVLDPTP
QQTSSGLFRCGPASVKAIREGEVHLPYDTPFVYAEVNADEVVWLLKDGQAQEILAHNTSS
IGKEISTKMVGSDQRQNITSSYKYPEGSPEERSVFMKASQKMLGVRRTSSPFLDLLGSGG
AVGQPAQLQLHLTRKPEWGQDVLLKLHARRVVDRAHPQGPIHLVVGFCAQTLLHNGGTRQ
PLWRQKVHLTLDFGEDIQWPLSLPYNNYRNKLTDEKLIRVSGIAKVEETGRFMLVLKDIS
LEPPHLSIEVSERAEVGKALRVHISLTNTLSVALSHCTMVLEGSGLINGQISNDLGTLVA
GHTIEIEVDLYPIKAGPRQLQVLVSSNEIKEIKGYKDIFVAAARAP
Download sequence
Identical sequences F1MJA2
ENSBTAP00000020482 ENSBTAP00000020482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]