SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020539 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020539
Domain Number 1 Region: 95-312,355-506
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.32e-95
Family Protein serine/threonine phosphatase 0.00000117
Further Details:      
 
Domain Number 2 Region: 489-640
Classification Level Classification E-value
Superfamily EF-hand 1.39e-23
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020539   Gene: ENSBTAG00000015449   Transcript: ENSBTAT00000020539
Sequence length 660
Comment pep:known_by_projection chromosome:UMD3.1:6:92450703:92479053:-1 gene:ENSBTAG00000015449 transcript:ENSBTAT00000020539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPRSPISQTGFSICVTAFRAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQVK
LHNFFSYLVDHFTPSSHNERELNRQFVPEASETQNCGDYDSIEVPDSYTGPRLSFPLLPD
HATALVEAFRRKQRLHARYVLNLLHEARKHLVQLPNINQVSTCYSEEITVCGDLHGQLDD
LIFIFYKKNGLPSPERAYVFNGDFVDRGKDSVEILMVLFAFMLVYPKEFHLNRGNHEDHI
VNLRYGFTKEVMHKYKIHGKKILKLLQDVFCWLPLATLVDEKVLILHGGVSDRTDLELLA
KLDRHKMKEVLHKPTQISRKSSEQSKLREAGGLESAESEVDSDAEEQPQPTPEEWRQVVD
ILWSDPMAQEGCRANTVRGGGCYFGPNVTERLLQKYHLQFLIRSHECKPEGYEFCHSRKV
LTIFSASNYYEVGSNRGAYVKLGPELTPHIMQFQANKATHMLTMRQRISRVEESALRALR
EKLFAHSSDILVEFKKHDKDETGLIALSDWAAAVESVLHLGLPWRMLRPQLVSSLTDNKL
AYKSWLENLAKEKLSQQNIQSSLLETLYRNRSNLETIFRIIDSDHSGSISLDEFRHTWKL
FSSHMNIDITDDCICDLARSIDFNKDGHIDINEFLEAFRLVEQSCSGGDVSDCPQVTNSS
Download sequence
Identical sequences E1B9Y5
ENSBTAP00000020539 ENSBTAP00000020539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]