SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020771 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020771
Domain Number 1 Region: 188-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-51
Family DBL homology domain (DH-domain) 0.000000309
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-38
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-32
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 4 Region: 667-768,817-843
Classification Level Classification E-value
Superfamily SH2 domain 3.58e-27
Family SH2 domain 0.00055
Further Details:      
 
Domain Number 5 Region: 589-697
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000272
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 6 Region: 784-832
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000228
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020771   Gene: ENSBTAG00000031575   Transcript: ENSBTAT00000020771
Sequence length 847
Comment pep:known_by_projection chromosome:UMD3.1:3:35428177:35861571:1 gene:ENSBTAG00000031575 transcript:ENSBTAT00000020771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVMLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDDDIYKGLPDLIDETHVEDEDGLYDCVYGEDEGGEVYEDLMKAE
EAQQSKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPMEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHIQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHEFKMHTFTRVTSCRVCQMLLRGTFFQ
GYLCVKCGARAHKECLGRVDNCSRVNSAEQGTLKPSEKRTNGLRRTHRPVDPGLPKMQAI
RSYSGTPPPALHEGPPLHIQAGDTVELLRGDAHSLFWQGRNLTSGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTRESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSTGQRGNRA
GISFLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
Download sequence
Identical sequences E1BBD2
XP_002686208.1.76553 XP_015318133.1.59421 ENSBTAP00000020771 ENSBTAP00000020771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]