SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020778 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020778
Domain Number 1 Region: 85-248
Classification Level Classification E-value
Superfamily EF-hand 2.15e-23
Family Calmodulin-like 0.017
Further Details:      
 
Domain Number 2 Region: 2-56
Classification Level Classification E-value
Superfamily EF-hand 0.00000000309
Family Polcalcin 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020778   Gene: ENSBTAG00000015642   Transcript: ENSBTAT00000020778
Sequence length 254
Comment pep:known chromosome:UMD3.1:16:52474085:52481382:1 gene:ENSBTAG00000015642 transcript:ENSBTAT00000020778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVDLNTDRRISAKEMQKWIMQKTAEHFQEAVAESRAHFRAVDPDGDGHVSWDEYKVKFLV
TKGHNEREVAEKIKNKWDLNIDEETQEVLENLKDRWYQADNPPPDLLLTESEFLSFLHPE
HSRGMLQFMVKEIIRDLDQDGDKKLSLSEFISLPVGTVENQQGQDVDDSWVRDRKREFEE
LIDANHDGIVTMAELEDYMDPMNEFSALNEAKQMIAIADENQNHYLEPEEVLKYSEFFTG
SKLVDYARSVHEEF
Download sequence
Identical sequences F1MKI5
ENSBTAP00000020778 ENSBTAP00000020778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]