SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020950 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020950
Domain Number 1 Region: 155-309
Classification Level Classification E-value
Superfamily EF-hand 2.61e-24
Family Calmodulin-like 0.073
Further Details:      
 
Domain Number 2 Region: 59-177
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000121
Family Calbindin D9K 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020950   Gene: ENSBTAG00000015780   Transcript: ENSBTAT00000020950
Sequence length 317
Comment pep:known chromosome:UMD3.1:21:32577840:32595997:1 gene:ENSBTAG00000015780 transcript:ENSBTAT00000020950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLGPRPATLGLLLLCAAAAGAGEAEELHYQQGEHRADYDREALLGGQEEVDEYVKLSPE
EQHKRLKSIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFIEYDKNSDGSVSWD
EYNIQMYDRVIDFVENTALDDAEEESFRQLHLKDKKRFEKANQDSGPGLNLEEFIAFEHP
EEVDYMTEFVIQEALEEHDKDGDGFVSLEEFLGDYRRDPTASEDPEWILVEKDRFMNDYD
RDADGRLDPQELLSWVVPNNQGIAQEEARHLIDEMDLNSDRKLSEEEILENQDLFLTSEA
TDYGRQLHDEYFYHDEL
Download sequence
Identical sequences Q0VCQ9
ENSBTAP00000020950 ENSBTAP00000020950 NP_001069047.1.59421 NP_001069047.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]