SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021209 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021209
Domain Number 1 Region: 11-190
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 4.32e-49
Family Isochorismatase-like hydrolases 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021209   Gene: ENSBTAG00000015950   Transcript: ENSBTAT00000021209
Sequence length 204
Comment pep:known_by_projection chromosome:UMD3.1:18:62502067:62508467:1 gene:ENSBTAG00000015950 transcript:ENSBTAT00000021209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPALGRVLPGSSMLFLCDMQEKFRHVVYFRQIVSVAARMLKVARLLSVPTVLTEQY
PQGLGPTVPELGAQGLQPYSKTCFSMVPAVQQELDARPQLRSVLLCGVETQACILQTALD
LLDRGLQVHVVVDACTSRSQVDRLVALSRLRQSGAFLSTSEGLIFQLVGDATHPQFKEIQ
KLVKEPSPDSGLLGLFQDQNPLFR
Download sequence
Identical sequences F1N6A0
XP_005219752.1.76553 XP_005906192.1.15283 ENSBTAP00000021209 9913.ENSBTAP00000021209 ENSBTAP00000021209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]