SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021391 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021391
Domain Number 1 Region: 111-294
Classification Level Classification E-value
Superfamily PH domain-like 2.81e-49
Family Phosphotyrosine-binding domain (PTB) 0.000000449
Further Details:      
 
Domain Number 2 Region: 456-563
Classification Level Classification E-value
Superfamily SH2 domain 1.04e-27
Family SH2 domain 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021391   Gene: ENSBTAG00000016072   Transcript: ENSBTAT00000021391
Sequence length 575
Comment pep:known_by_projection chromosome:UMD3.1:7:44723005:44753033:-1 gene:ENSBTAG00000016072 transcript:ENSBTAT00000021391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPAGFLSRGPAAARAAGGAGAA
DPEPEPASPAGVPALAAADPNCQAVLCWPPPPRRRWGPGSHGVTAGPQLPWEWVRKAGFC
ITPAAGWIHDHSRKLSPFVSSWVQYMGCIEVLRSMRSLDFSTRTQVTREAINRLHEAVPG
VRGSWKKKAPNKALASILGKSNLRFAGMSIAVSISIDGLNLSVPATRQIIANHHMQSISF
ASGGDTDMADYVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPRV
VVPPERLTGMEDSAWGDEEEVEHNYYNSLPGKEPPPGGLVDSRLALTQPCALGVLGALGQ
GASPARRDARGLQWDVGPSVPAQPGDGYVQADARGPRDYEDHLYVNTQGLDGPESLQPED
SPKKDLFDMRPFEDALRLHECSVAAGSVAAPLPVEDQWPSPPTRRAPIAPTEEQLRQEPW
YHGQMSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHGGQPKHLLLVDPEGVVRTKDVL
FESISHLIDYHLQNGQPIVAAESELHLRGVVKREP
Download sequence
Identical sequences F1N5N3
ENSBTAP00000021391 ENSBTAP00000021391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]