SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021395 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021395
Domain Number 1 Region: 20-94
Classification Level Classification E-value
Superfamily PDZ domain-like 7.06e-18
Family PDZ domain 0.0000851
Further Details:      
 
Domain Number 2 Region: 211-267
Classification Level Classification E-value
Superfamily EF-hand 0.0000264
Family Calmodulin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021395   Gene: ENSBTAG00000016078   Transcript: ENSBTAT00000021395
Sequence length 500
Comment pep:known chromosome:UMD3.1:19:5316762:5516685:1 gene:ENSBTAG00000016078 transcript:ENSBTAT00000021395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKNTSSVVSSSLLEKDPAFQMITVTKKTGLGLKILGGINRNEGPLVYIQEIIPGGDCYK
DGRLKPGDQLVSVNKESMIGVSFEEAKGIITRAKLRSESSWEIAFIRQKSDSSHLENPSC
SSLLEATGEYGPHASKFSLISSPETLIPKTSSTPRSTDAILPSLRRNQIKTGYKKTEQIP
ITSSDNSPTDMSNTEYSPSWTDNYGPQGKKISLNPSVRVKVEKLEMALNYLGIQPTKEQH
QALRQQVQVDTKGTVSFGDFVHVARNLFCLQLDEANVGAHEISSILNSQFLPCDSLETDE
VEKLKHERNNALEEVKTLKEKLFESERQRKQLTEELQNVKQEAKAVVEETRALRSRLHLA
EAAQRQAQGMEMDYEEVIRLLEAEITELKAQLADYSDQNKESVQELRKRITVLDCQLRKS
EMARKTFEASTEKLLHFVEAIQDVFSDNSAPLSNLSERRALLASQTSLTPLGKNGHNIPA
TLALESKELVKSVRAILDMD
Download sequence
Identical sequences E1BAL5
ENSBTAP00000021395 ENSBTAP00000021395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]