SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021449 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021449
Domain Number 1 Region: 15-172
Classification Level Classification E-value
Superfamily EF-hand 9.09e-42
Family Calmodulin-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021449   Gene: ENSBTAG00000016114   Transcript: ENSBTAT00000021449
Sequence length 173
Comment pep:known chromosome:UMD3.1:18:55294576:55303680:-1 gene:ENSBTAG00000016114 transcript:ENSBTAT00000021449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFPMGPACIFLRKGIAEKQRERPLGPDEIEELREAFLEFDKDRDGFISCKDLGNLMRTM
GYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDAN
GDGEITLGELQQAMQRLLGDKLTSQEISEVVQEADINGDGTVDFEEFVKMMSR
Download sequence
Identical sequences L8IKL8 Q9N1Q8
9913.ENSBTAP00000021449 ENSBTAP00000021449 ENSBTAP00000021449 NP_777153.1.59421 NP_777153.1.76553 XP_006067489.1.26621 XP_010847842.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]